PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.H04039.1.p
Common NameEUGRSUZ_H04039
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GRAS
Protein Properties Length: 596aa    MW: 66952.2 Da    PI: 5.1317
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.H04039.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS281.82e-862235912372
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykal.ppsetsekn.sseelaalklfsevsPil 91 
                       v lLl +Ae v ++++++a++lL++   l+s++g+ +qRl++yf+eAL++r+ r s+   ++++ + ++ +++  + + ++++ ++++  P++
  Eucgr.H04039.1.p 223 VLLLLFAAEKVYHQEFHRASKLLNQCDYLCSNKGNQIQRLVFYFAEALHERIDRgSGRIPVNTCgKGQKPDPQAqTMNPMQSRIAYHQELPFV 315
                       568999************************************************5555445555333333333325555566666******** PP

              GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlva 183
                       ++++++  qaI+e v+ +++vH+iD+di  GlQW  L+qaLas   ++   l+iT+vg    +sk+ + etg+rL +fA+++ +pf f+ +v+
  Eucgr.H04039.1.p 316 QVAQFAGVQAIVENVADAKKVHVIDLDIAFGLQWTILMQALASCYdRQIELLKITAVGT---SSKHLIDETGKRLVNFAQSMSLPFTFKSVVV 405
                       ******************************************76647788*********...579999************************* PP

              GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                        ++ dl+ e ++++++Ea++V +++ l +l  ++  les    ++k++++++P+v+vv+e ea+hns++F +rf+e+l +++a+fd++ea+++
  Eucgr.H04039.1.p 406 GDVLDLKEELFEIDTEEAVVVYSQFFLWTLIPQPNRLES----LMKVIRKTNPRVMVVAEVEANHNSPNFGNRFIESLFFHAACFDCFEASMS 494
                       *******************************88887777....************************************************** PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLv 368
                       re+++r+ +E  ++g+ ++n++a+eg+er  r+ +   Wr+ + ++ + +++ls++   qa+l+++k++ ++  +++ + ++l+ gWk+ p++
  Eucgr.H04039.1.p 495 REDSNRMAIESIFFGQGVKNILATEGEERMVRTVKIDVWRAFFARFSMIEAELSSSSLYQANLVMKKFGcGRFCTLDMNGKCLLVGWKGTPVL 587
                       *********************************************************************999899****************** PP

              GRAS 369 svSa 372
                       s+S+
  Eucgr.H04039.1.p 588 SLSV 591
                       *996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.945196572IPR005202Transcription factor GRAS
PfamPF035146.9E-84223591IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
MTSTMFSFGA FDPVGILENL GSNNELDDVV GGRSGSKQSH YREEDWRDSS FTGTLSSDFG  60
LYRDNLSESD FGFSKYQLQN QEENPLPAHD LLDDLNFEVD CPPLQTCLKE IANLGSKQIG  120
IQDSQDEKEK GHPFLLASLE LLKNYGHRLK KLDGDKIVEL SSNTSLSRLS EQNLSTEEII  180
RLAGVNFIQT TSSVGDPLAA FSHPYRLSFS DLSDQEMKDA QLVLLLLFAA EKVYHQEFHR  240
ASKLLNQCDY LCSNKGNQIQ RLVFYFAEAL HERIDRGSGR IPVNTCGKGQ KPDPQAQTMN  300
PMQSRIAYHQ ELPFVQVAQF AGVQAIVENV ADAKKVHVID LDIAFGLQWT ILMQALASCY  360
DRQIELLKIT AVGTSSKHLI DETGKRLVNF AQSMSLPFTF KSVVVGDVLD LKEELFEIDT  420
EEAVVVYSQF FLWTLIPQPN RLESLMKVIR KTNPRVMVVA EVEANHNSPN FGNRFIESLF  480
FHAACFDCFE ASMSREDSNR MAIESIFFGQ GVKNILATEG EERMVRTVKI DVWRAFFARF  540
SMIEAELSSS SLYQANLVMK KFGCGRFCTL DMNGKCLLVG WKGTPVLSLS VLKFI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3125259333375GRAS family transcription factor containing p
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.H04039.1.p
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010027100.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A059B6J20.0A0A059B6J2_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM157861014
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.11e-52RGA-like 2